Placeholder image of a protein
Icon representing a puzzle

1293: Dysferlin C2B Domain: Predicted Contacts

Closed since over 9 years ago

Intermediate

Summary

Created
October 07, 2016
Expires
Max points
100
Description

Note: This puzzle was mistakenly posted without a Contact Bonus filter. The puzzle has been closed and reposted as Puzzle 1293b.



This is a followup to Puzzle 1291, now with predicted contacts! This domain of the human dysferlin protein; see the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Players may load in solutions from Puzzle 1291.



Sequence:


DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,359
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 47 pts. 9,229
  3. Avatar for Gargleblasters 3. Gargleblasters 19 pts. 9,142
  4. Avatar for Void Crushers 4. Void Crushers 7 pts. 8,640
  5. Avatar for Contenders 5. Contenders 2 pts. 8,562
  6. Avatar for Deleted group 6. Deleted group pts. 8,132
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 1 pt. 3,218
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 1 pt. 1,822
  1. Avatar for pandapharmd 21. pandapharmd Lv 1 1 pt. 3,691
  2. Avatar for Museka 22. Museka Lv 1 1 pt. 3,218
  3. Avatar for carsonfb 23. carsonfb Lv 1 1 pt. 3,068
  4. Avatar for bendbob 24. bendbob Lv 1 1 pt. 3,068
  5. Avatar for xplocast1 25. xplocast1 Lv 1 1 pt. 2,786
  6. Avatar for reefyrob 26. reefyrob Lv 1 1 pt. 2,625
  7. Avatar for deLaCeiba 27. deLaCeiba Lv 1 1 pt. 1,822
  8. Avatar for hansvandenhof 28. hansvandenhof Lv 1 1 pt. 1,759
  9. Avatar for markm457 29. markm457 Lv 1 1 pt. 1,690
  10. Avatar for gitwut 30. gitwut Lv 1 1 pt. 1,623

Comments