Placeholder image of a protein
Icon representing a puzzle

1293b: Dysferlin C2B Domain: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
October 07, 2016
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1293, which lacked a Contact Bonus filter. Players may load in solutions from Puzzle 1293.



This is a followup to Puzzle 1291, now with predicted contacts! This domain of the human dysferlin protein; see the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Players may load in solutions from Puzzle 1291.



Sequence:


DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,853
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,369
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,614
  4. Avatar for xkcd 14. xkcd 1 pt. 8,553
  5. Avatar for freefolder 15. freefolder 1 pt. 7,284
  6. Avatar for Biochem-AD17 16. Biochem-AD17 1 pt. 4,605
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,559
  8. Avatar for Rice Biochemistry 18. Rice Biochemistry 1 pt. 0
  1. Avatar for pizpot 191. pizpot Lv 1 1 pt. 2,655
  2. Avatar for Ronmore 192. Ronmore Lv 1 1 pt. 2,649
  3. Avatar for Tolen 193. Tolen Lv 1 1 pt. 2,484
  4. Avatar for GreyDex 194. GreyDex Lv 1 1 pt. 2,313
  5. Avatar for krisha_lim 195. krisha_lim Lv 1 1 pt. 0
  6. Avatar for Parnikkapore 196. Parnikkapore Lv 1 1 pt. 0
  7. Avatar for 01010011111 197. 01010011111 Lv 1 1 pt. 0
  8. Avatar for momadoc 198. momadoc Lv 1 1 pt. 0
  9. Avatar for justjustin 199. justjustin Lv 1 1 pt. 0
  10. Avatar for jesusyanez15 200. jesusyanez15 Lv 1 1 pt. 0

Comments

bkoep Staff Lv 1

Yes, there is a lot of data to support these contact predictions. Most of the contacts are high confidence (bright green).