Placeholder image of a protein
Icon representing a puzzle

1293b: Dysferlin C2B Domain: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
October 07, 2016
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1293, which lacked a Contact Bonus filter. Players may load in solutions from Puzzle 1293.



This is a followup to Puzzle 1291, now with predicted contacts! This domain of the human dysferlin protein; see the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Players may load in solutions from Puzzle 1291.



Sequence:


DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,853
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,369
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,614
  4. Avatar for xkcd 14. xkcd 1 pt. 8,553
  5. Avatar for freefolder 15. freefolder 1 pt. 7,284
  6. Avatar for Biochem-AD17 16. Biochem-AD17 1 pt. 4,605
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,559
  8. Avatar for Rice Biochemistry 18. Rice Biochemistry 1 pt. 0
  1. Avatar for johnmitch 31. johnmitch Lv 1 47 pts. 11,393
  2. Avatar for alcor29 32. alcor29 Lv 1 46 pts. 11,354
  3. Avatar for jobo0502 33. jobo0502 Lv 1 45 pts. 11,341
  4. Avatar for Museka 34. Museka Lv 1 44 pts. 11,255
  5. Avatar for MurloW 35. MurloW Lv 1 43 pts. 11,228
  6. Avatar for mimi 36. mimi Lv 1 41 pts. 11,116
  7. Avatar for joremen 37. joremen Lv 1 40 pts. 11,020
  8. Avatar for O Seki To 38. O Seki To Lv 1 39 pts. 10,898
  9. Avatar for pvc78 39. pvc78 Lv 1 38 pts. 10,854
  10. Avatar for Deleted player 40. Deleted player pts. 10,836

Comments

bkoep Staff Lv 1

Yes, there is a lot of data to support these contact predictions. Most of the contacts are high confidence (bright green).