Placeholder image of a protein
Icon representing a puzzle

1293b: Dysferlin C2B Domain: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
October 07, 2016
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1293, which lacked a Contact Bonus filter. Players may load in solutions from Puzzle 1293.



This is a followup to Puzzle 1291, now with predicted contacts! This domain of the human dysferlin protein; see the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Players may load in solutions from Puzzle 1291.



Sequence:


DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 14,429
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 13,552
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 13,171
  4. Avatar for Contenders 4. Contenders 38 pts. 13,141
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 13,009
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 12,319
  7. Avatar for Go Science 7. Go Science 12 pts. 12,032
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 10,898
  9. Avatar for Deleted group 9. Deleted group pts. 10,542
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 10,310
  1. Avatar for johnmitch 31. johnmitch Lv 1 47 pts. 11,393
  2. Avatar for alcor29 32. alcor29 Lv 1 46 pts. 11,354
  3. Avatar for jobo0502 33. jobo0502 Lv 1 45 pts. 11,341
  4. Avatar for Museka 34. Museka Lv 1 44 pts. 11,255
  5. Avatar for MurloW 35. MurloW Lv 1 43 pts. 11,228
  6. Avatar for mimi 36. mimi Lv 1 41 pts. 11,116
  7. Avatar for joremen 37. joremen Lv 1 40 pts. 11,020
  8. Avatar for O Seki To 38. O Seki To Lv 1 39 pts. 10,898
  9. Avatar for pvc78 39. pvc78 Lv 1 38 pts. 10,854
  10. Avatar for Deleted player 40. Deleted player pts. 10,836

Comments

bkoep Staff Lv 1

Yes, there is a lot of data to support these contact predictions. Most of the contacts are high confidence (bright green).