Placeholder image of a protein
Icon representing a puzzle

1293b: Dysferlin C2B Domain: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
October 07, 2016
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1293, which lacked a Contact Bonus filter. Players may load in solutions from Puzzle 1293.



This is a followup to Puzzle 1291, now with predicted contacts! This domain of the human dysferlin protein; see the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Players may load in solutions from Puzzle 1291.



Sequence:


DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 14,429
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 13,552
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 13,171
  4. Avatar for Contenders 4. Contenders 38 pts. 13,141
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 13,009
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 12,319
  7. Avatar for Go Science 7. Go Science 12 pts. 12,032
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 10,898
  9. Avatar for Deleted group 9. Deleted group pts. 10,542
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 10,310

  1. Avatar for martin.szew 51. martin.szew Lv 1 27 pts. 10,444
  2. Avatar for hpaege 52. hpaege Lv 1 26 pts. 10,402
  3. Avatar for Bletchley Park 53. Bletchley Park Lv 1 25 pts. 10,383
  4. Avatar for weitzen 54. weitzen Lv 1 25 pts. 10,377
  5. Avatar for stomjoh 55. stomjoh Lv 1 24 pts. 10,359
  6. Avatar for uihcv 56. uihcv Lv 1 23 pts. 10,314
  7. Avatar for deLaCeiba 57. deLaCeiba Lv 1 22 pts. 10,310
  8. Avatar for guineapig 58. guineapig Lv 1 22 pts. 10,215
  9. Avatar for Vinara 59. Vinara Lv 1 21 pts. 10,153
  10. Avatar for g_b 60. g_b Lv 1 20 pts. 10,080

Comments


bkoep Staff Lv 1

Yes, there is a lot of data to support these contact predictions. Most of the contacts are high confidence (bright green).