Placeholder image of a protein
Icon representing a puzzle

1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for It's over 9000! 11. It's over 9000! 4 pts. 8,758
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 8,418
  3. Avatar for xkcd 13. xkcd 2 pts. 8,412
  4. Avatar for freefolder 14. freefolder 1 pt. 8,278
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,231
  6. Avatar for Deleted group 16. Deleted group pts. 8,140
  7. Avatar for Rice Biochemistry 17. Rice Biochemistry 1 pt. 7,977
  8. Avatar for Biochem-AD17 18. Biochem-AD17 1 pt. 7,787
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 7,110
  10. Avatar for Natural Abilities 20. Natural Abilities 1 pt. 6,802

  1. Avatar for meatexplosion 101. meatexplosion Lv 1 5 pts. 8,473
  2. Avatar for SaraL 102. SaraL Lv 1 5 pts. 8,472
  3. Avatar for mcummings 103. mcummings Lv 1 5 pts. 8,457
  4. Avatar for kvasirthewise 104. kvasirthewise Lv 1 4 pts. 8,438
  5. Avatar for aendgraend 105. aendgraend Lv 1 4 pts. 8,418
  6. Avatar for fryguy 106. fryguy Lv 1 4 pts. 8,412
  7. Avatar for ivalnic 107. ivalnic Lv 1 4 pts. 8,410
  8. Avatar for weitzen 108. weitzen Lv 1 4 pts. 8,402
  9. Avatar for Arne Heessels 109. Arne Heessels Lv 1 4 pts. 8,384
  10. Avatar for monkry 110. monkry Lv 1 3 pts. 8,383

Comments