1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Summary

• Created: October 12, 2016
• Expires: October 19, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

• 1. Beta Folders 100 pts. 9,245
• 2. Anthropic Dreams 78 pts. 9,244
• 3. Contenders 60 pts. 9,239
• 4. Gargleblasters 45 pts. 9,233
• 5. Go Science 33 pts. 9,224
• 6. Void Crushers 24 pts. 9,177
• 7. L'Alliance Francophone 17 pts. 9,175
• 8. HMT heritage 12 pts. 9,165
• 9. Russian team 8 pts. 9,120
• 10. Italiani Al Lavoro 6 pts. 9,028

Top soloists

• 1. dcrwheeler 100 pts. 9,251
• 2. markm457 98 pts. 9,239
• 3. retiredmichael 96 pts. 9,236
• 4. LociOiling 94 pts. 9,233
• 5. Bletchley Park 92 pts. 9,233
• 6. frood66 89 pts. 9,233
• 7. smilingone 87 pts. 9,230
• 8. Aubade01 85 pts. 9,226
• 9. Scopper 83 pts. 9,224
• 10. bertro 81 pts. 9,222