Placeholder image of a protein
Icon representing a puzzle

1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for It's over 9000! 11. It's over 9000! 4 pts. 8,758
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 8,418
  3. Avatar for xkcd 13. xkcd 2 pts. 8,412
  4. Avatar for freefolder 14. freefolder 1 pt. 8,278
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,231
  6. Avatar for Deleted group 16. Deleted group pts. 8,140
  7. Avatar for Rice Biochemistry 17. Rice Biochemistry 1 pt. 7,977
  8. Avatar for Biochem-AD17 18. Biochem-AD17 1 pt. 7,787
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 7,110
  10. Avatar for Natural Abilities 20. Natural Abilities 1 pt. 6,802

  1. Avatar for demeter900 161. demeter900 Lv 1 1 pt. 7,886
  2. Avatar for jencimons 162. jencimons Lv 1 1 pt. 7,854
  3. Avatar for Superphosphate 163. Superphosphate Lv 1 1 pt. 7,833
  4. Avatar for Anamfija 164. Anamfija Lv 1 1 pt. 7,812
  5. Avatar for LazyEyeGuy 165. LazyEyeGuy Lv 1 1 pt. 7,810
  6. Avatar for nagistick 166. nagistick Lv 1 1 pt. 7,803
  7. Avatar for TheGUmmer 167. TheGUmmer Lv 1 1 pt. 7,800
  8. Avatar for Dempy 168. Dempy Lv 1 1 pt. 7,789
  9. Avatar for Master Deebo 169. Master Deebo Lv 1 1 pt. 7,788
  10. Avatar for A01630805 170. A01630805 Lv 1 1 pt. 7,787

Comments