Placeholder image of a protein
Icon representing a puzzle

1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 4 pts. 8,758
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 8,418
  3. Avatar for xkcd 13. xkcd 2 pts. 8,412
  4. Avatar for freefolder 14. freefolder 1 pt. 8,278
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,231
  6. Avatar for Deleted group 16. Deleted group pts. 8,140
  7. Avatar for Rice Biochemistry 17. Rice Biochemistry 1 pt. 7,977
  8. Avatar for Biochem-AD17 18. Biochem-AD17 1 pt. 7,787
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 7,110
  10. Avatar for Natural Abilities 20. Natural Abilities 1 pt. 6,802
  1. Avatar for Phosphoros042 171. Phosphoros042 Lv 1 1 pt. 7,786
  2. Avatar for Deleted player 172. Deleted player pts. 7,782
  3. Avatar for Marvelz 173. Marvelz Lv 1 1 pt. 7,774
  4. Avatar for martinf 174. martinf Lv 1 1 pt. 7,768
  5. Avatar for borattt 175. borattt Lv 1 1 pt. 7,763
  6. Avatar for eragon50714 176. eragon50714 Lv 1 1 pt. 7,762
  7. Avatar for penteplayer 177. penteplayer Lv 1 1 pt. 7,752
  8. Avatar for parsnip 178. parsnip Lv 1 1 pt. 7,752
  9. Avatar for Ref_Jo 179. Ref_Jo Lv 1 1 pt. 7,749
  10. Avatar for cnhrcolemam 180. cnhrcolemam Lv 1 1 pt. 7,742

Comments