Placeholder image of a protein
Icon representing a puzzle

1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 4 pts. 8,758
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 8,418
  3. Avatar for xkcd 13. xkcd 2 pts. 8,412
  4. Avatar for freefolder 14. freefolder 1 pt. 8,278
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,231
  6. Avatar for Deleted group 16. Deleted group pts. 8,140
  7. Avatar for Rice Biochemistry 17. Rice Biochemistry 1 pt. 7,977
  8. Avatar for Biochem-AD17 18. Biochem-AD17 1 pt. 7,787
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 7,110
  10. Avatar for Natural Abilities 20. Natural Abilities 1 pt. 6,802
  1. Avatar for Zenny 191. Zenny Lv 1 1 pt. 7,532
  2. Avatar for notfoldme 192. notfoldme Lv 1 1 pt. 7,529
  3. Avatar for matttmo 193. matttmo Lv 1 1 pt. 7,508
  4. Avatar for JackONeill12 194. JackONeill12 Lv 1 1 pt. 7,505
  5. Avatar for JBeesty 195. JBeesty Lv 1 1 pt. 7,499
  6. Avatar for Wilm 196. Wilm Lv 1 1 pt. 7,380
  7. Avatar for racingsnailrider 197. racingsnailrider Lv 1 1 pt. 7,290
  8. Avatar for Aldrovanda 198. Aldrovanda Lv 1 1 pt. 7,157
  9. Avatar for immac636 199. immac636 Lv 1 1 pt. 7,138
  10. Avatar for aspadistra 200. aspadistra Lv 1 1 pt. 7,110

Comments