Placeholder image of a protein
Icon representing a puzzle

1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups



  1. Avatar for alongruss 141. alongruss Lv 1 1 pt. 8,031
  2. Avatar for jebbiek 142. jebbiek Lv 1 1 pt. 8,030
  3. Avatar for krisha_lim 143. krisha_lim Lv 1 1 pt. 8,023
  4. Avatar for yycrr333666999 144. yycrr333666999 Lv 1 1 pt. 8,018
  5. Avatar for Sylva 145. Sylva Lv 1 1 pt. 8,017
  6. Avatar for SouperGenious 146. SouperGenious Lv 1 1 pt. 7,982
  7. Avatar for cwl3 147. cwl3 Lv 1 1 pt. 7,977
  8. Avatar for Merf 148. Merf Lv 1 1 pt. 7,964
  9. Avatar for Bulder 149. Bulder Lv 1 1 pt. 7,949
  10. Avatar for cobaltteal 150. cobaltteal Lv 1 1 pt. 7,925

Comments