Placeholder image of a protein
Icon representing a puzzle

1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
October 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Medical Problem Solving II Home Page 21. Medical Problem Solving II Home Page 1 pt. 6,749
  1. Avatar for patgainz 181. patgainz Lv 1 1 pt. 7,730
  2. Avatar for mirjamvandelft 182. mirjamvandelft Lv 1 1 pt. 7,726
  3. Avatar for 01010011111 183. 01010011111 Lv 1 1 pt. 7,715
  4. Avatar for A01225950 184. A01225950 Lv 1 1 pt. 7,691
  5. Avatar for streatmatthew 185. streatmatthew Lv 1 1 pt. 7,675
  6. Avatar for Ciccillo 186. Ciccillo Lv 1 1 pt. 7,636
  7. Avatar for Cerzax 187. Cerzax Lv 1 1 pt. 7,629
  8. Avatar for syrup1551 188. syrup1551 Lv 1 1 pt. 7,619
  9. Avatar for wudoo 189. wudoo Lv 1 1 pt. 7,612
  10. Avatar for RathjeF 190. RathjeF Lv 1 1 pt. 7,593

Comments