Placeholder image of a protein
Icon representing a puzzle

1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups



  1. Avatar for Haker53535 211. Haker53535 Lv 1 1 pt. 6,559
  2. Avatar for Sarifiniv 212. Sarifiniv Lv 1 1 pt. 6,559
  3. Avatar for lamoille 213. lamoille Lv 1 1 pt. 6,559
  4. Avatar for jord508 214. jord508 Lv 1 1 pt. 6,559
  5. Avatar for Rollyanne 215. Rollyanne Lv 1 1 pt. 6,559
  6. Avatar for bkoep 216. bkoep Lv 1 1 pt. 6,559

Comments