Placeholder image of a protein
Icon representing a puzzle

1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups



  1. Avatar for nicobul 31. nicobul Lv 1 48 pts. 9,147
  2. Avatar for Bruno Kestemont 32. Bruno Kestemont Lv 1 46 pts. 9,142
  3. Avatar for isaksson 33. isaksson Lv 1 45 pts. 9,137
  4. Avatar for Keresto 34. Keresto Lv 1 44 pts. 9,130
  5. Avatar for tallguy-13088 35. tallguy-13088 Lv 1 43 pts. 9,123
  6. Avatar for Blipperman 36. Blipperman Lv 1 42 pts. 9,117
  7. Avatar for randomlil 37. randomlil Lv 1 41 pts. 9,116
  8. Avatar for grogar7 38. grogar7 Lv 1 39 pts. 9,114
  9. Avatar for joremen 39. joremen Lv 1 38 pts. 9,110
  10. Avatar for diamond_dust 40. diamond_dust Lv 1 37 pts. 9,100

Comments