Placeholder image of a protein
Icon representing a puzzle

1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups



  1. Avatar for pmthomson90 61. pmthomson90 Lv 1 20 pts. 9,023
  2. Avatar for WBarme1234 62. WBarme1234 Lv 1 19 pts. 9,022
  3. Avatar for NinjaGreg 63. NinjaGreg Lv 1 19 pts. 9,009
  4. Avatar for Vinara 64. Vinara Lv 1 18 pts. 8,992
  5. Avatar for Museka 65. Museka Lv 1 18 pts. 8,978
  6. Avatar for JayD7217 66. JayD7217 Lv 1 17 pts. 8,975
  7. Avatar for dbuske 67. dbuske Lv 1 16 pts. 8,974
  8. Avatar for pfirth 68. pfirth Lv 1 16 pts. 8,970
  9. Avatar for TomTaylor 69. TomTaylor Lv 1 15 pts. 8,951
  10. Avatar for Glen B 70. Glen B Lv 1 15 pts. 8,928

Comments