Placeholder image of a protein
Icon representing a puzzle

1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups



  1. Avatar for gurch 71. gurch Lv 1 14 pts. 8,927
  2. Avatar for jamiexq 72. jamiexq Lv 1 14 pts. 8,920
  3. Avatar for Deleted player 73. Deleted player 14 pts. 8,918
  4. Avatar for MicElephant 74. MicElephant Lv 1 13 pts. 8,909
  5. Avatar for bendbob 75. bendbob Lv 1 13 pts. 8,908
  6. Avatar for alcor29 76. alcor29 Lv 1 12 pts. 8,901
  7. Avatar for smholst 77. smholst Lv 1 12 pts. 8,899
  8. Avatar for alwen 78. alwen Lv 1 11 pts. 8,895
  9. Avatar for diamonddays 79. diamonddays Lv 1 11 pts. 8,890
  10. Avatar for georg137 80. georg137 Lv 1 11 pts. 8,889

Comments