Placeholder image of a protein
Icon representing a puzzle

1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups



  1. Avatar for fishercat 81. fishercat Lv 1 10 pts. 8,860
  2. Avatar for benchagot 82. benchagot Lv 1 10 pts. 8,859
  3. Avatar for Deleted player 83. Deleted player pts. 8,831
  4. Avatar for ViJay7019 84. ViJay7019 Lv 1 9 pts. 8,825
  5. Avatar for Jim Fraser 85. Jim Fraser Lv 1 9 pts. 8,821
  6. Avatar for deLaCeiba 86. deLaCeiba Lv 1 9 pts. 8,810
  7. Avatar for uihcv 87. uihcv Lv 1 8 pts. 8,805
  8. Avatar for crpainter 88. crpainter Lv 1 8 pts. 8,803
  9. Avatar for dssb 89. dssb Lv 1 8 pts. 8,795
  10. Avatar for stomjoh 90. stomjoh Lv 1 7 pts. 8,791

Comments