1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Summary

• Created: October 12, 2016
• Expires: October 19, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

• 1. Beta Folders 100 pts. 9,245
• 2. Anthropic Dreams 78 pts. 9,244
• 3. Contenders 60 pts. 9,239
• 4. Gargleblasters 45 pts. 9,233
• 5. Go Science 33 pts. 9,224
• 6. Void Crushers 24 pts. 9,177
• 7. L'Alliance Francophone 17 pts. 9,175
• 8. HMT heritage 12 pts. 9,165
• 9. Russian team 8 pts. 9,120
• 10. Italiani Al Lavoro 6 pts. 9,028

Top evolvers

• 1. smilingone 100 pts. 9,245
• 2. bertro 86 pts. 9,244
• 3. LociOiling 74 pts. 9,244
• 4. retiredmichael 63 pts. 9,244
• 5. Galaxie 53 pts. 9,244
• 6. gmn 44 pts. 9,239
• 7. gitwut 37 pts. 9,239
• 8. dembones 31 pts. 9,239
• 9. actiasluna 25 pts. 9,233
• 10. mimi 21 pts. 9,231