Placeholder image of a protein
Icon representing a puzzle

1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,245
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,244
  3. Avatar for Contenders 3. Contenders 60 pts. 9,239
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,233
  5. Avatar for Go Science 5. Go Science 33 pts. 9,224
  6. Avatar for Void Crushers 6. Void Crushers 24 pts. 9,177
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,175
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,165
  9. Avatar for Russian team 9. Russian team 8 pts. 9,120
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 9,028

  1. Avatar for justjustin 121. justjustin Lv 1 2 pts. 8,243
  2. Avatar for placid.lion 122. placid.lion Lv 1 2 pts. 8,232
  3. Avatar for Savas 123. Savas Lv 1 2 pts. 8,231
  4. Avatar for poiuyqwert 124. poiuyqwert Lv 1 2 pts. 8,180
  5. Avatar for NotJim99 125. NotJim99 Lv 1 2 pts. 8,175
  6. Avatar for boondog 126. boondog Lv 1 2 pts. 8,171
  7. Avatar for Stixxy 127. Stixxy Lv 1 2 pts. 8,156
  8. Avatar for Psych0Active 128. Psych0Active Lv 1 2 pts. 8,140
  9. Avatar for andrewxc 129. andrewxc Lv 1 2 pts. 8,124
  10. Avatar for Mutabis 130. Mutabis Lv 1 2 pts. 8,123

Comments