Placeholder image of a protein
Icon representing a puzzle

1295: Revisiting Puzzle 74: Platypus Venom

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,245
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,244
  3. Avatar for Contenders 3. Contenders 60 pts. 9,239
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,233
  5. Avatar for Go Science 5. Go Science 33 pts. 9,224
  6. Avatar for Void Crushers 6. Void Crushers 24 pts. 9,177
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,175
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,165
  9. Avatar for Russian team 9. Russian team 8 pts. 9,120
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 9,028

  1. Avatar for demeter900 161. demeter900 Lv 1 1 pt. 7,886
  2. Avatar for jencimons 162. jencimons Lv 1 1 pt. 7,854
  3. Avatar for Superphosphate 163. Superphosphate Lv 1 1 pt. 7,833
  4. Avatar for Anamfija 164. Anamfija Lv 1 1 pt. 7,812
  5. Avatar for LazyEyeGuy 165. LazyEyeGuy Lv 1 1 pt. 7,810
  6. Avatar for nagistick 166. nagistick Lv 1 1 pt. 7,803
  7. Avatar for TheGUmmer 167. TheGUmmer Lv 1 1 pt. 7,800
  8. Avatar for Dempy 168. Dempy Lv 1 1 pt. 7,789
  9. Avatar for Master Deebo 169. Master Deebo Lv 1 1 pt. 7,788
  10. Avatar for A01630805 170. A01630805 Lv 1 1 pt. 7,787

Comments