Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Russian team 11. Russian team 5 pts. 8,810
  2. Avatar for freefolder 12. freefolder 4 pts. 8,704
  3. Avatar for Deleted group 13. Deleted group pts. 8,466
  4. Avatar for SETI.Germany 14. SETI.Germany 2 pts. 8,466
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,451
  6. Avatar for Deleted group 16. Deleted group pts. 8,407
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,395
  8. Avatar for Deleted group 18. Deleted group pts. 8,382
  9. Avatar for Biochem-AD17 19. Biochem-AD17 1 pt. 8,301
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,294

  1. Avatar for jobo0502 31. jobo0502 Lv 1 48 pts. 8,934
  2. Avatar for gitwut 32. gitwut Lv 1 46 pts. 8,933
  3. Avatar for grogar7 33. grogar7 Lv 1 45 pts. 8,931
  4. Avatar for Deleted player 34. Deleted player pts. 8,929
  5. Avatar for Scopper 35. Scopper Lv 1 43 pts. 8,926
  6. Avatar for pvc78 36. pvc78 Lv 1 42 pts. 8,924
  7. Avatar for Bletchley Park 37. Bletchley Park Lv 1 41 pts. 8,916
  8. Avatar for g_b 38. g_b Lv 1 39 pts. 8,911
  9. Avatar for WBarme1234 39. WBarme1234 Lv 1 38 pts. 8,902
  10. Avatar for tallguy-13088 40. tallguy-13088 Lv 1 37 pts. 8,898

Comments


Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)