Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Russian team 11. Russian team 5 pts. 8,810
  2. Avatar for freefolder 12. freefolder 4 pts. 8,704
  3. Avatar for Deleted group 13. Deleted group pts. 8,466
  4. Avatar for SETI.Germany 14. SETI.Germany 2 pts. 8,466
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,451
  6. Avatar for Deleted group 16. Deleted group pts. 8,407
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,395
  8. Avatar for Deleted group 18. Deleted group pts. 8,382
  9. Avatar for Biochem-AD17 19. Biochem-AD17 1 pt. 8,301
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,294

  1. Avatar for ComputerMage 81. ComputerMage Lv 1 10 pts. 8,810
  2. Avatar for alwen 82. alwen Lv 1 10 pts. 8,807
  3. Avatar for manu8170 83. manu8170 Lv 1 10 pts. 8,806
  4. Avatar for SaraL 84. SaraL Lv 1 9 pts. 8,805
  5. Avatar for JUMELLE54 85. JUMELLE54 Lv 1 9 pts. 8,804
  6. Avatar for froggs554 86. froggs554 Lv 1 9 pts. 8,800
  7. Avatar for tarimo 87. tarimo Lv 1 8 pts. 8,794
  8. Avatar for cobaltteal 88. cobaltteal Lv 1 8 pts. 8,784
  9. Avatar for cherry39 89. cherry39 Lv 1 8 pts. 8,777
  10. Avatar for ralan-nsk 90. ralan-nsk Lv 1 7 pts. 8,777

Comments


Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)