Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for INFINITAS 21. INFINITAS 1 pt. 8,200
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  3. Avatar for Natural Abilities 23. Natural Abilities 1 pt. 0
  1. Avatar for haabermaaster 151. haabermaaster Lv 1 1 pt. 8,451
  2. Avatar for Mike Cassidy 152. Mike Cassidy Lv 1 1 pt. 8,448
  3. Avatar for jamiexq 153. jamiexq Lv 1 1 pt. 8,446
  4. Avatar for katanyag 154. katanyag Lv 1 1 pt. 8,428
  5. Avatar for ErazorOne 155. ErazorOne Lv 1 1 pt. 8,427
  6. Avatar for biyokimya_2016_alpcan 156. biyokimya_2016_alpcan Lv 1 1 pt. 8,407
  7. Avatar for sheerbliss 157. sheerbliss Lv 1 1 pt. 8,400
  8. Avatar for Savas 158. Savas Lv 1 1 pt. 8,395
  9. Avatar for lamoille 159. lamoille Lv 1 1 pt. 8,391
  10. Avatar for mcummings 160. mcummings Lv 1 1 pt. 8,387

Comments

Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)