Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,009
  2. Avatar for Contenders 2. Contenders 80 pts. 9,000
  3. Avatar for Go Science 3. Go Science 63 pts. 8,991
  4. Avatar for Beta Folders 4. Beta Folders 49 pts. 8,990
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 8,990
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 8,981
  7. Avatar for Gargleblasters 7. Gargleblasters 21 pts. 8,971
  8. Avatar for HMT heritage 8. HMT heritage 15 pts. 8,969
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 8,836
  10. Avatar for xkcd 10. xkcd 8 pts. 8,833

  1. Avatar for haabermaaster 151. haabermaaster Lv 1 1 pt. 8,451
  2. Avatar for Mike Cassidy 152. Mike Cassidy Lv 1 1 pt. 8,448
  3. Avatar for jamiexq 153. jamiexq Lv 1 1 pt. 8,446
  4. Avatar for katanyag 154. katanyag Lv 1 1 pt. 8,428
  5. Avatar for ErazorOne 155. ErazorOne Lv 1 1 pt. 8,427
  6. Avatar for sheerbliss 157. sheerbliss Lv 1 1 pt. 8,400
  7. Avatar for Savas 158. Savas Lv 1 1 pt. 8,395
  8. Avatar for lamoille 159. lamoille Lv 1 1 pt. 8,391
  9. Avatar for mcummings 160. mcummings Lv 1 1 pt. 8,387

Comments


Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)