Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for INFINITAS 21. INFINITAS 1 pt. 8,200
  2. Avatar for Window Group 22. Window Group 1 pt. 0

  1. Avatar for drumpeter18yrs9yrs 161. drumpeter18yrs9yrs Lv 1 1 pt. 8,382
  2. Avatar for isantheautumn 162. isantheautumn Lv 1 1 pt. 8,381
  3. Avatar for averagebeverage 163. averagebeverage Lv 1 1 pt. 8,380
  4. Avatar for Gleb Ptitsyn 164. Gleb Ptitsyn Lv 1 1 pt. 8,378
  5. Avatar for Stixxy 165. Stixxy Lv 1 1 pt. 8,371
  6. Avatar for Tophatosaurus 166. Tophatosaurus Lv 1 1 pt. 8,362
  7. Avatar for Cerzax 167. Cerzax Lv 1 1 pt. 8,359
  8. Avatar for Petrifolder 168. Petrifolder Lv 1 1 pt. 8,358
  9. Avatar for penteplayer 169. penteplayer Lv 1 1 pt. 8,356
  10. Avatar for Iron pet 170. Iron pet Lv 1 1 pt. 8,351

Comments


Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)