Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,009
  2. Avatar for Contenders 2. Contenders 80 pts. 9,000
  3. Avatar for Go Science 3. Go Science 63 pts. 8,991
  4. Avatar for Beta Folders 4. Beta Folders 49 pts. 8,990
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 8,990
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 8,981
  7. Avatar for Gargleblasters 7. Gargleblasters 21 pts. 8,971
  8. Avatar for HMT heritage 8. HMT heritage 15 pts. 8,969
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 8,836
  10. Avatar for xkcd 10. xkcd 8 pts. 8,833
  1. Avatar for drumpeter18yrs9yrs 161. drumpeter18yrs9yrs Lv 1 1 pt. 8,382
  2. Avatar for isantheautumn 162. isantheautumn Lv 1 1 pt. 8,381
  3. Avatar for averagebeverage 163. averagebeverage Lv 1 1 pt. 8,380
  4. Avatar for Gleb Ptitsyn 164. Gleb Ptitsyn Lv 1 1 pt. 8,378
  5. Avatar for Stixxy 165. Stixxy Lv 1 1 pt. 8,371
  6. Avatar for Tophatosaurus 166. Tophatosaurus Lv 1 1 pt. 8,362
  7. Avatar for Cerzax 167. Cerzax Lv 1 1 pt. 8,359
  8. Avatar for Petrifolder 168. Petrifolder Lv 1 1 pt. 8,358
  9. Avatar for penteplayer 169. penteplayer Lv 1 1 pt. 8,356
  10. Avatar for Iron pet 170. Iron pet Lv 1 1 pt. 8,351

Comments

Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)