Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for INFINITAS 21. INFINITAS 1 pt. 8,200
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  3. Avatar for Natural Abilities 23. Natural Abilities 1 pt. 0
  1. Avatar for pauldunn 11. pauldunn Lv 1 79 pts. 8,982
  2. Avatar for Timo van der Laan 12. Timo van der Laan Lv 1 77 pts. 8,981
  3. Avatar for smilingone 13. smilingone Lv 1 76 pts. 8,978
  4. Avatar for mimi 14. mimi Lv 1 74 pts. 8,976
  5. Avatar for fiendish_ghoul 15. fiendish_ghoul Lv 1 72 pts. 8,973
  6. Avatar for crpainter 16. crpainter Lv 1 70 pts. 8,969
  7. Avatar for O Seki To 17. O Seki To Lv 1 68 pts. 8,969
  8. Avatar for Mike Lewis 18. Mike Lewis Lv 1 67 pts. 8,966
  9. Avatar for Keresto 19. Keresto Lv 1 65 pts. 8,964
  10. Avatar for Bruno Kestemont 20. Bruno Kestemont Lv 1 63 pts. 8,961

Comments

Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)