Placeholder image of a protein
Icon representing a puzzle

1300: Revisiting Puzzle 75 with Density: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
October 25, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 5 pts. 12,343
  2. Avatar for freefolder 12. freefolder 4 pts. 12,163
  3. Avatar for DSN @ Home 13. DSN @ Home 2 pts. 12,059
  4. Avatar for xkcd 14. xkcd 2 pts. 11,314
  5. Avatar for HMT heritage 15. HMT heritage 1 pt. 9,468
  6. Avatar for Storm 16. Storm 1 pt. 8,981
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 8,811
  8. Avatar for INFINITAS 18. INFINITAS 1 pt. 8,810
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 8,598
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 8,569

  1. Avatar for meatexplosion 91. meatexplosion Lv 1 4 pts. 12,351
  2. Avatar for haabermaaster 92. haabermaaster Lv 1 4 pts. 12,343
  3. Avatar for Savas 93. Savas Lv 1 4 pts. 12,343
  4. Avatar for impjong 94. impjong Lv 1 3 pts. 12,293
  5. Avatar for stephen_elijah 96. stephen_elijah Lv 1 3 pts. 12,262
  6. Avatar for senor pit 97. senor pit Lv 1 3 pts. 12,239
  7. Avatar for parsnip 98. parsnip Lv 1 3 pts. 12,235
  8. Avatar for Iron pet 99. Iron pet Lv 1 3 pts. 12,233
  9. Avatar for marsfan 100. marsfan Lv 1 3 pts. 12,228

Comments