Placeholder image of a protein
Icon representing a puzzle

1300: Revisiting Puzzle 75 with Density: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
October 25, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,711
  2. Avatar for Go Science 2. Go Science 80 pts. 12,706
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 12,706
  4. Avatar for Gargleblasters 4. Gargleblasters 49 pts. 12,700
  5. Avatar for Contenders 5. Contenders 37 pts. 12,700
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 12,695
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 12,691
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 15 pts. 12,644
  9. Avatar for Deleted group 9. Deleted group pts. 12,597
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 8 pts. 12,343
  1. Avatar for markm457
    1. markm457 Lv 1
    100 pts. 12,710
  2. Avatar for diamond_dust 2. diamond_dust Lv 1 98 pts. 12,706
  3. Avatar for LociOiling 3. LociOiling Lv 1 95 pts. 12,705
  4. Avatar for Aubade01 4. Aubade01 Lv 1 93 pts. 12,704
  5. Avatar for Vredeman 5. Vredeman Lv 1 90 pts. 12,704
  6. Avatar for reefyrob 6. reefyrob Lv 1 88 pts. 12,703
  7. Avatar for tokens 7. tokens Lv 1 85 pts. 12,702
  8. Avatar for bertro 8. bertro Lv 1 83 pts. 12,701
  9. Avatar for retiredmichael 9. retiredmichael Lv 1 81 pts. 12,701
  10. Avatar for Galaxie 10. Galaxie Lv 1 78 pts. 12,700

Comments