Placeholder image of a protein
Icon representing a puzzle

1300: Revisiting Puzzle 75 with Density: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
October 25, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 5 pts. 12,343
  2. Avatar for freefolder 12. freefolder 4 pts. 12,163
  3. Avatar for DSN @ Home 13. DSN @ Home 2 pts. 12,059
  4. Avatar for xkcd 14. xkcd 2 pts. 11,314
  5. Avatar for HMT heritage 15. HMT heritage 1 pt. 9,468
  6. Avatar for Storm 16. Storm 1 pt. 8,981
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 8,811
  8. Avatar for INFINITAS 18. INFINITAS 1 pt. 8,810
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 8,598
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 8,569

  1. Avatar for jeff101 111. jeff101 Lv 1 2 pts. 9,259
  2. Avatar for johngran 112. johngran Lv 1 1 pt. 9,258
  3. Avatar for SKSbell 113. SKSbell Lv 1 1 pt. 9,209
  4. Avatar for Sissue 114. Sissue Lv 1 1 pt. 9,102
  5. Avatar for Vinara 115. Vinara Lv 1 1 pt. 9,096
  6. Avatar for froggs554 116. froggs554 Lv 1 1 pt. 9,094
  7. Avatar for JUMELLE54 117. JUMELLE54 Lv 1 1 pt. 9,077
  8. Avatar for mitarcher 118. mitarcher Lv 1 1 pt. 9,064
  9. Avatar for Merf 119. Merf Lv 1 1 pt. 9,063
  10. Avatar for ManVsYard 120. ManVsYard Lv 1 1 pt. 9,041

Comments