Placeholder image of a protein
Icon representing a puzzle

1300: Revisiting Puzzle 75 with Density: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
October 25, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 5 pts. 12,343
  2. Avatar for freefolder 12. freefolder 4 pts. 12,163
  3. Avatar for DSN @ Home 13. DSN @ Home 2 pts. 12,059
  4. Avatar for xkcd 14. xkcd 2 pts. 11,314
  5. Avatar for HMT heritage 15. HMT heritage 1 pt. 9,468
  6. Avatar for Storm 16. Storm 1 pt. 8,981
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 8,811
  8. Avatar for INFINITAS 18. INFINITAS 1 pt. 8,810
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 8,598
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 8,569
  1. Avatar for BCAA 131. BCAA Lv 1 1 pt. 8,811
  2. Avatar for TheEnderCavalier 132. TheEnderCavalier Lv 1 1 pt. 8,810
  3. Avatar for Auntecedent 133. Auntecedent Lv 1 1 pt. 8,787
  4. Avatar for Hollinas 134. Hollinas Lv 1 1 pt. 8,785
  5. Avatar for tomespen 135. tomespen Lv 1 1 pt. 8,764
  6. Avatar for Eugenitor 136. Eugenitor Lv 1 1 pt. 8,746
  7. Avatar for pandapharmd 137. pandapharmd Lv 1 1 pt. 8,744
  8. Avatar for cherry39 138. cherry39 Lv 1 1 pt. 8,737
  9. Avatar for ZekeGabriel 139. ZekeGabriel Lv 1 1 pt. 8,651
  10. Avatar for martinf 140. martinf Lv 1 1 pt. 8,651

Comments