Placeholder image of a protein
Icon representing a puzzle

1300: Revisiting Puzzle 75 with Density: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
October 25, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 5 pts. 12,343
  2. Avatar for freefolder 12. freefolder 4 pts. 12,163
  3. Avatar for DSN @ Home 13. DSN @ Home 2 pts. 12,059
  4. Avatar for xkcd 14. xkcd 2 pts. 11,314
  5. Avatar for HMT heritage 15. HMT heritage 1 pt. 9,468
  6. Avatar for Storm 16. Storm 1 pt. 8,981
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 8,811
  8. Avatar for INFINITAS 18. INFINITAS 1 pt. 8,810
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 8,598
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 8,569

  1. Avatar for minkyuk00 151. minkyuk00 Lv 1 1 pt. 8,421
  2. Avatar for Tac1 152. Tac1 Lv 1 1 pt. 8,405
  3. Avatar for thatswave 153. thatswave Lv 1 1 pt. 8,399
  4. Avatar for A01631674 154. A01631674 Lv 1 1 pt. 8,395
  5. Avatar for Mutabis 155. Mutabis Lv 1 1 pt. 8,394
  6. Avatar for pizpot 156. pizpot Lv 1 1 pt. 8,380
  7. Avatar for Mike Cassidy 157. Mike Cassidy Lv 1 1 pt. 8,372
  8. Avatar for mirjamvandelft 158. mirjamvandelft Lv 1 1 pt. 8,325
  9. Avatar for backster 159. backster Lv 1 1 pt. 8,298
  10. Avatar for NotJim99 160. NotJim99 Lv 1 1 pt. 8,287

Comments