Placeholder image of a protein
Icon representing a puzzle

1300: Revisiting Puzzle 75 with Density: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
October 25, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 5 pts. 12,343
  2. Avatar for freefolder 12. freefolder 4 pts. 12,163
  3. Avatar for DSN @ Home 13. DSN @ Home 2 pts. 12,059
  4. Avatar for xkcd 14. xkcd 2 pts. 11,314
  5. Avatar for HMT heritage 15. HMT heritage 1 pt. 9,468
  6. Avatar for Storm 16. Storm 1 pt. 8,981
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 8,811
  8. Avatar for INFINITAS 18. INFINITAS 1 pt. 8,810
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 8,598
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 8,569
  1. Avatar for fiendish_ghoul 31. fiendish_ghoul Lv 1 42 pts. 12,688
  2. Avatar for pvc78 32. pvc78 Lv 1 40 pts. 12,687
  3. Avatar for Museka 33. Museka Lv 1 39 pts. 12,687
  4. Avatar for pauldunn 34. pauldunn Lv 1 38 pts. 12,684
  5. Avatar for randomlil 35. randomlil Lv 1 37 pts. 12,684
  6. Avatar for Keresto 36. Keresto Lv 1 35 pts. 12,683
  7. Avatar for actiasluna 37. actiasluna Lv 1 34 pts. 12,681
  8. Avatar for jobo0502 38. jobo0502 Lv 1 33 pts. 12,680
  9. Avatar for kabubi 39. kabubi Lv 1 32 pts. 12,679
  10. Avatar for Bruno Kestemont 40. Bruno Kestemont Lv 1 31 pts. 12,678

Comments