Placeholder image of a protein
Icon representing a puzzle

1300: Revisiting Puzzle 75 with Density: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
October 25, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 5 pts. 12,343
  2. Avatar for freefolder 12. freefolder 4 pts. 12,163
  3. Avatar for DSN @ Home 13. DSN @ Home 2 pts. 12,059
  4. Avatar for xkcd 14. xkcd 2 pts. 11,314
  5. Avatar for HMT heritage 15. HMT heritage 1 pt. 9,468
  6. Avatar for Storm 16. Storm 1 pt. 8,981
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 8,811
  8. Avatar for INFINITAS 18. INFINITAS 1 pt. 8,810
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 8,598
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 8,569
  1. Avatar for Geyalust 41. Geyalust Lv 1 30 pts. 12,678
  2. Avatar for alwen 42. alwen Lv 1 29 pts. 12,678
  3. Avatar for shettler 43. shettler Lv 1 28 pts. 12,677
  4. Avatar for Deleted player 44. Deleted player pts. 12,675
  5. Avatar for Formula350 45. Formula350 Lv 1 26 pts. 12,674
  6. Avatar for Anfinsen_slept_here 46. Anfinsen_slept_here Lv 1 25 pts. 12,670
  7. Avatar for Scopper 47. Scopper Lv 1 24 pts. 12,670
  8. Avatar for georg137 48. georg137 Lv 1 23 pts. 12,668
  9. Avatar for alcor29 49. alcor29 Lv 1 23 pts. 12,668
  10. Avatar for diamonddays 50. diamonddays Lv 1 22 pts. 12,655

Comments