Placeholder image of a protein
Icon representing a puzzle

1300: Revisiting Puzzle 75 with Density: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
October 25, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 5 pts. 12,343
  2. Avatar for freefolder 12. freefolder 4 pts. 12,163
  3. Avatar for DSN @ Home 13. DSN @ Home 2 pts. 12,059
  4. Avatar for xkcd 14. xkcd 2 pts. 11,314
  5. Avatar for HMT heritage 15. HMT heritage 1 pt. 9,468
  6. Avatar for Storm 16. Storm 1 pt. 8,981
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 8,811
  8. Avatar for INFINITAS 18. INFINITAS 1 pt. 8,810
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 8,598
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 8,569
  1. Avatar for xplocast1 81. xplocast1 Lv 1 6 pts. 12,527
  2. Avatar for Inkedhands 82. Inkedhands Lv 1 6 pts. 12,527
  3. Avatar for WBarme1234 83. WBarme1234 Lv 1 6 pts. 12,513
  4. Avatar for Tehnologik1 84. Tehnologik1 Lv 1 5 pts. 12,475
  5. Avatar for Paulo Roque 85. Paulo Roque Lv 1 5 pts. 12,461
  6. Avatar for pfirth 86. pfirth Lv 1 5 pts. 12,443
  7. Avatar for ZiiONIC 87. ZiiONIC Lv 1 5 pts. 12,401
  8. Avatar for weitzen 88. weitzen Lv 1 5 pts. 12,397
  9. Avatar for Kiwegapa 89. Kiwegapa Lv 1 4 pts. 12,382
  10. Avatar for monkry 90. monkry Lv 1 4 pts. 12,380

Comments