Placeholder image of a protein
Icon representing a puzzle

1300: Revisiting Puzzle 75 with Density: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
October 25, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups



  1. Avatar for leehaggis 121. leehaggis Lv 1 1 pt. 9,040
  2. Avatar for navn 122. navn Lv 1 1 pt. 9,034
  3. Avatar for jebbiek 123. jebbiek Lv 1 1 pt. 9,029
  4. Avatar for brofessor 124. brofessor Lv 1 1 pt. 8,981
  5. Avatar for jamiexq 125. jamiexq Lv 1 1 pt. 8,969
  6. Avatar for rinze 126. rinze Lv 1 1 pt. 8,957
  7. Avatar for SpriteSAMA 127. SpriteSAMA Lv 1 1 pt. 8,885
  8. Avatar for tweak64 128. tweak64 Lv 1 1 pt. 8,864
  9. Avatar for racingsnailrider 129. racingsnailrider Lv 1 1 pt. 8,815
  10. Avatar for demeter900 130. demeter900 Lv 1 1 pt. 8,815

Comments