Placeholder image of a protein
Icon representing a puzzle

1300: Revisiting Puzzle 75 with Density: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
October 25, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,069
  2. Avatar for Seymour High School Honors Biology I 2018 22. Seymour High School Honors Biology I 2018 1 pt. 0
  3. Avatar for Tiger Biochem 330 23. Tiger Biochem 330 1 pt. 0
  1. Avatar for komnor 171. komnor Lv 1 1 pt. 7,660
  2. Avatar for attylass 172. attylass Lv 1 1 pt. 5,233
  3. Avatar for arthurjcs 173. arthurjcs Lv 1 1 pt. 1,500
  4. Avatar for saksoft2 174. saksoft2 Lv 1 1 pt. 0
  5. Avatar for lptx 175. lptx Lv 1 1 pt. 0
  6. Avatar for packer 176. packer Lv 1 1 pt. 0
  7. Avatar for severin333 177. severin333 Lv 1 1 pt. 0
  8. Avatar for emtonsti 178. emtonsti Lv 1 1 pt. 0
  9. Avatar for JGA 179. JGA Lv 1 1 pt. 0
  10. Avatar for ssikich1 180. ssikich1 Lv 1 1 pt. 0

Comments