Placeholder image of a protein
Icon representing a puzzle

1300: Revisiting Puzzle 75 with Density: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
October 25, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,069
  2. Avatar for Seymour High School Honors Biology I 2018 22. Seymour High School Honors Biology I 2018 1 pt. 0
  3. Avatar for Tiger Biochem 330 23. Tiger Biochem 330 1 pt. 0
  1. Avatar for guineapig 51. guineapig Lv 1 21 pts. 12,654
  2. Avatar for ncameron 52. ncameron Lv 1 20 pts. 12,649
  3. Avatar for Glen B 53. Glen B Lv 1 20 pts. 12,645
  4. Avatar for Bushman 54. Bushman Lv 1 19 pts. 12,644
  5. Avatar for SaraL 55. SaraL Lv 1 18 pts. 12,638
  6. Avatar for Alistair69 56. Alistair69 Lv 1 17 pts. 12,634
  7. Avatar for caglar 57. caglar Lv 1 17 pts. 12,629
  8. Avatar for eusair 58. eusair Lv 1 16 pts. 12,629
  9. Avatar for dbuske 59. dbuske Lv 1 16 pts. 12,625
  10. Avatar for MicElephant 60. MicElephant Lv 1 15 pts. 12,619

Comments