Placeholder image of a protein
Icon representing a puzzle

1300: Revisiting Puzzle 75 with Density: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
October 25, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups



  1. Avatar for smilingone 61. smilingone Lv 1 14 pts. 12,612
  2. Avatar for Deleted player 62. Deleted player pts. 12,611
  3. Avatar for johngran2 63. johngran2 Lv 1 13 pts. 12,609
  4. Avatar for Bautho 64. Bautho Lv 1 13 pts. 12,600
  5. Avatar for drumpeter18yrs9yrs 65. drumpeter18yrs9yrs Lv 1 12 pts. 12,597
  6. Avatar for stomjoh 66. stomjoh Lv 1 12 pts. 12,596
  7. Avatar for gurch 67. gurch Lv 1 11 pts. 12,595
  8. Avatar for cobaltteal 68. cobaltteal Lv 1 11 pts. 12,587
  9. Avatar for isaksson 69. isaksson Lv 1 10 pts. 12,583
  10. Avatar for ZeroLeak7 70. ZeroLeak7 Lv 1 10 pts. 12,578

Comments