1300: Revisiting Puzzle 75 with Density: Antifreeze Protein
Closed since over 9 years ago
Intermediate Intermediate Overall Overall Prediction Prediction Electron Density Electron DensitySummary
- Created
- October 25, 2016
- Expires
- Max points
- 100
This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.
Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA
Top groups
-
100 pts. 12,711
-
-
-
-
-
-
-
-
-