Placeholder image of a protein
Icon representing a puzzle

1300: Revisiting Puzzle 75 with Density: Antifreeze Protein

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
October 25, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,711
  2. Avatar for Go Science 2. Go Science 80 pts. 12,706
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 12,706
  4. Avatar for Gargleblasters 4. Gargleblasters 49 pts. 12,700
  5. Avatar for Contenders 5. Contenders 37 pts. 12,700
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 12,695
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 12,691
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 15 pts. 12,644
  9. Avatar for Deleted group 9. Deleted group pts. 12,597
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 8 pts. 12,343

  1. Avatar for guineapig 51. guineapig Lv 1 21 pts. 12,654
  2. Avatar for ncameron 52. ncameron Lv 1 20 pts. 12,649
  3. Avatar for Glen B 53. Glen B Lv 1 20 pts. 12,645
  4. Avatar for Bushman 54. Bushman Lv 1 19 pts. 12,644
  5. Avatar for SaraL 55. SaraL Lv 1 18 pts. 12,638
  6. Avatar for Alistair69 56. Alistair69 Lv 1 17 pts. 12,634
  7. Avatar for caglar 57. caglar Lv 1 17 pts. 12,629
  8. Avatar for eusair 58. eusair Lv 1 16 pts. 12,629
  9. Avatar for dbuske 59. dbuske Lv 1 16 pts. 12,625
  10. Avatar for MicElephant 60. MicElephant Lv 1 15 pts. 12,619

Comments