Placeholder image of a protein
Icon representing a puzzle

1300: Revisiting Puzzle 75 with Density: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
October 25, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,711
  2. Avatar for Go Science 2. Go Science 80 pts. 12,706
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 12,706
  4. Avatar for Gargleblasters 4. Gargleblasters 49 pts. 12,700
  5. Avatar for Contenders 5. Contenders 37 pts. 12,700
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 12,695
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 12,691
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 15 pts. 12,644
  9. Avatar for Deleted group 9. Deleted group pts. 12,597
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 8 pts. 12,343
  1. Avatar for Thebatman012 141. Thebatman012 Lv 1 1 pt. 8,642
  2. Avatar for aendgraend 142. aendgraend Lv 1 1 pt. 8,598
  3. Avatar for A01630489 143. A01630489 Lv 1 1 pt. 8,569
  4. Avatar for lamoille 144. lamoille Lv 1 1 pt. 8,560
  5. Avatar for turbolag 145. turbolag Lv 1 1 pt. 8,559
  6. Avatar for ivalnic 146. ivalnic Lv 1 1 pt. 8,526
  7. Avatar for krisha_lim 147. krisha_lim Lv 1 1 pt. 8,523
  8. Avatar for Kujonj32 148. Kujonj32 Lv 1 1 pt. 8,490
  9. Avatar for phi16 149. phi16 Lv 1 1 pt. 8,455
  10. Avatar for Cerzax 150. Cerzax Lv 1 1 pt. 8,431

Comments