Placeholder image of a protein
Icon representing a puzzle

1300: Revisiting Puzzle 75 with Density: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
October 25, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,711
  2. Avatar for Go Science 2. Go Science 80 pts. 12,706
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 12,706
  4. Avatar for Gargleblasters 4. Gargleblasters 49 pts. 12,700
  5. Avatar for Contenders 5. Contenders 37 pts. 12,700
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 12,695
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 12,691
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 15 pts. 12,644
  9. Avatar for Deleted group 9. Deleted group pts. 12,597
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 8 pts. 12,343
  1. Avatar for gitwut 11. gitwut Lv 1 76 pts. 12,700
  2. Avatar for johnmitch 12. johnmitch Lv 1 74 pts. 12,700
  3. Avatar for Susume 13. Susume Lv 1 72 pts. 12,700
  4. Avatar for Mike Lewis 14. Mike Lewis Lv 1 70 pts. 12,699
  5. Avatar for Deleted player 15. Deleted player pts. 12,698
  6. Avatar for grogar7 16. grogar7 Lv 1 66 pts. 12,696
  7. Avatar for dcrwheeler 17. dcrwheeler Lv 1 64 pts. 12,696
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 62 pts. 12,695
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 60 pts. 12,695
  10. Avatar for nicobul 20. nicobul Lv 1 58 pts. 12,695

Comments