Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 7,783
  2. Avatar for BiboKids 12. BiboKids 1 pt. 7,413
  3. Avatar for Deleted group 14. Deleted group pts. 6,871
  4. Avatar for AST Biology 15. AST Biology 1 pt. 6,281
  5. Avatar for Russian team 16. Russian team 1 pt. 5,907
  6. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,465

  1. Avatar for Nathan Solibaga 121. Nathan Solibaga Lv 1 1 pt. 7,809
  2. Avatar for Arne Heessels 122. Arne Heessels Lv 1 1 pt. 7,796
  3. Avatar for tomespen 123. tomespen Lv 1 1 pt. 7,785
  4. Avatar for Savas 124. Savas Lv 1 1 pt. 7,783
  5. Avatar for jencimons 126. jencimons Lv 1 1 pt. 7,730
  6. Avatar for Gleb Ptitsyn 127. Gleb Ptitsyn Lv 1 1 pt. 7,704
  7. Avatar for pandapharmd 128. pandapharmd Lv 1 1 pt. 7,647
  8. Avatar for chadlitan 129. chadlitan Lv 1 1 pt. 7,599
  9. Avatar for EdgeDetect 130. EdgeDetect Lv 1 1 pt. 7,565

Comments