Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 7,783
  2. Avatar for BiboKids 12. BiboKids 1 pt. 7,413
  3. Avatar for Freeport Honors Biology 13. Freeport Honors Biology 1 pt. 7,124
  4. Avatar for Deleted group 14. Deleted group pts. 6,871
  5. Avatar for AST Biology 15. AST Biology 1 pt. 6,281
  6. Avatar for Russian team 16. Russian team 1 pt. 5,907
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,465
  1. Avatar for notfoldme 171. notfoldme Lv 1 1 pt. 5,080
  2. Avatar for TastyMunchies 172. TastyMunchies Lv 1 1 pt. 4,920
  3. Avatar for kgyk 173. kgyk Lv 1 1 pt. 4,864
  4. Avatar for krmonopoli 174. krmonopoli Lv 1 1 pt. 4,638
  5. Avatar for metatoma 175. metatoma Lv 1 1 pt. 0
  6. Avatar for bullfrog 176. bullfrog Lv 1 1 pt. 0
  7. Avatar for ManVsYard 177. ManVsYard Lv 1 1 pt. 0
  8. Avatar for ivalnic 178. ivalnic Lv 1 1 pt. 0
  9. Avatar for lamoille 179. lamoille Lv 1 1 pt. 0
  10. Avatar for shenh2 180. shenh2 Lv 1 1 pt. 0

Comments