Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 7,783
  2. Avatar for BiboKids 12. BiboKids 1 pt. 7,413
  3. Avatar for Freeport Honors Biology 13. Freeport Honors Biology 1 pt. 7,124
  4. Avatar for Deleted group 14. Deleted group pts. 6,871
  5. Avatar for AST Biology 15. AST Biology 1 pt. 6,281
  6. Avatar for Russian team 16. Russian team 1 pt. 5,907
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,465
  1. Avatar for retiredmichael 21. retiredmichael Lv 1 57 pts. 9,376
  2. Avatar for jermainiac 22. jermainiac Lv 1 55 pts. 9,374
  3. Avatar for Vredeman 23. Vredeman Lv 1 53 pts. 9,373
  4. Avatar for Bruno Kestemont 24. Bruno Kestemont Lv 1 52 pts. 9,363
  5. Avatar for dcrwheeler 25. dcrwheeler Lv 1 50 pts. 9,361
  6. Avatar for Blipperman 26. Blipperman Lv 1 49 pts. 9,361
  7. Avatar for actiasluna 27. actiasluna Lv 1 47 pts. 9,359
  8. Avatar for grogar7 28. grogar7 Lv 1 46 pts. 9,356
  9. Avatar for shettler 29. shettler Lv 1 44 pts. 9,354
  10. Avatar for NinjaGreg 30. NinjaGreg Lv 1 43 pts. 9,349

Comments