Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 7,783
  2. Avatar for BiboKids 12. BiboKids 1 pt. 7,413
  3. Avatar for Deleted group 14. Deleted group pts. 6,871
  4. Avatar for AST Biology 15. AST Biology 1 pt. 6,281
  5. Avatar for Russian team 16. Russian team 1 pt. 5,907
  6. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,465

  1. Avatar for WBarme1234 61. WBarme1234 Lv 1 14 pts. 9,127
  2. Avatar for Anfinsen_slept_here 62. Anfinsen_slept_here Lv 1 14 pts. 9,083
  3. Avatar for dssb 63. dssb Lv 1 13 pts. 9,077
  4. Avatar for christioanchauvin 64. christioanchauvin Lv 1 13 pts. 9,069
  5. Avatar for stomjoh 65. stomjoh Lv 1 12 pts. 9,068
  6. Avatar for georg137 66. georg137 Lv 1 12 pts. 9,051
  7. Avatar for diamonddays 67. diamonddays Lv 1 11 pts. 9,034
  8. Avatar for guineapig 68. guineapig Lv 1 11 pts. 9,030
  9. Avatar for Tehnologik1 69. Tehnologik1 Lv 1 10 pts. 9,025
  10. Avatar for Deleted player 70. Deleted player pts. 9,019

Comments