Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups


  1. Avatar for Contenders 100 pts. 9,530
  2. Avatar for Go Science 2. Go Science 73 pts. 9,517
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,495
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,494
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,468
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,453
  7. Avatar for Deleted group 7. Deleted group pts. 9,448
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,396
  9. Avatar for xkcd 9. xkcd 4 pts. 9,287
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 8,464

  1. Avatar for notfoldme 171. notfoldme Lv 1 1 pt. 5,080
  2. Avatar for TastyMunchies 172. TastyMunchies Lv 1 1 pt. 4,920
  3. Avatar for kgyk 173. kgyk Lv 1 1 pt. 4,864
  4. Avatar for krmonopoli 174. krmonopoli Lv 1 1 pt. 4,638
  5. Avatar for bullfrog 175. bullfrog Lv 1 1 pt. 0
  6. Avatar for Deleted player 176. Deleted player pts. 0
  7. Avatar for ManVsYard 177. ManVsYard Lv 1 1 pt. 0
  8. Avatar for ivalnic 178. ivalnic Lv 1 1 pt. 0
  9. Avatar for lamoille 179. lamoille Lv 1 1 pt. 0
  10. Avatar for shenh2 180. shenh2 Lv 1 1 pt. 0

Comments