Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups


  1. Avatar for Contenders 100 pts. 9,530
  2. Avatar for Go Science 2. Go Science 73 pts. 9,517
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,495
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,494
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,468
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,453
  7. Avatar for Deleted group 7. Deleted group pts. 9,448
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,396
  9. Avatar for xkcd 9. xkcd 4 pts. 9,287
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 8,464

  1. Avatar for WBarme1234 61. WBarme1234 Lv 1 14 pts. 9,127
  2. Avatar for Anfinsen_slept_here 62. Anfinsen_slept_here Lv 1 14 pts. 9,083
  3. Avatar for dssb 63. dssb Lv 1 13 pts. 9,077
  4. Avatar for christioanchauvin 64. christioanchauvin Lv 1 13 pts. 9,069
  5. Avatar for stomjoh 65. stomjoh Lv 1 12 pts. 9,068
  6. Avatar for georg137 66. georg137 Lv 1 12 pts. 9,051
  7. Avatar for diamonddays 67. diamonddays Lv 1 11 pts. 9,034
  8. Avatar for guineapig 68. guineapig Lv 1 11 pts. 9,030
  9. Avatar for Tehnologik1 69. Tehnologik1 Lv 1 10 pts. 9,025
  10. Avatar for Deleted player 70. Deleted player pts. 9,019

Comments