Placeholder image of a protein
Icon representing a puzzle

1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 5 pts. 8,774
  2. Avatar for HMT heritage 12. HMT heritage 4 pts. 8,761
  3. Avatar for xkcd 13. xkcd 2 pts. 8,745
  4. Avatar for Deleted group 14. Deleted group pts. 8,496
  5. Avatar for freefolder 15. freefolder 1 pt. 8,487
  6. Avatar for Kantiii 16. Kantiii 1 pt. 8,301
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,261
  8. Avatar for Freeport Honors Biology 18. Freeport Honors Biology 1 pt. 8,191
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,187
  10. Avatar for BiboKids 20. BiboKids 1 pt. 8,144
  1. Avatar for xuco9 201. xuco9 Lv 1 1 pt. 8,041
  2. Avatar for Gleb Ptitsyn 202. Gleb Ptitsyn Lv 1 1 pt. 8,028
  3. Avatar for Ciccillo 203. Ciccillo Lv 1 1 pt. 7,993
  4. Avatar for emtonsti 204. emtonsti Lv 1 1 pt. 7,993
  5. Avatar for komnor 205. komnor Lv 1 1 pt. 7,967
  6. Avatar for LBFANAT 206. LBFANAT Lv 1 1 pt. 7,964
  7. Avatar for NotJim99 207. NotJim99 Lv 1 1 pt. 7,950
  8. Avatar for wiktoriusz 208. wiktoriusz Lv 1 1 pt. 7,949
  9. Avatar for nsmangat 209. nsmangat Lv 1 1 pt. 7,946
  10. Avatar for sor2018 210. sor2018 Lv 1 1 pt. 7,911

Comments