Placeholder image of a protein
Icon representing a puzzle

1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,196
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,186
  3. Avatar for Gargleblasters 3. Gargleblasters 63 pts. 9,139
  4. Avatar for Go Science 4. Go Science 49 pts. 9,126
  5. Avatar for Void Crushers 5. Void Crushers 37 pts. 9,111
  6. Avatar for Contenders 6. Contenders 28 pts. 9,103
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,077
  8. Avatar for Deleted group 8. Deleted group pts. 9,054
  9. Avatar for Russian team 9. Russian team 11 pts. 8,970
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 8 pts. 8,945
  1. Avatar for xuco9 201. xuco9 Lv 1 1 pt. 8,041
  2. Avatar for Gleb Ptitsyn 202. Gleb Ptitsyn Lv 1 1 pt. 8,028
  3. Avatar for Ciccillo 203. Ciccillo Lv 1 1 pt. 7,993
  4. Avatar for emtonsti 204. emtonsti Lv 1 1 pt. 7,993
  5. Avatar for komnor 205. komnor Lv 1 1 pt. 7,967
  6. Avatar for LBFANAT 206. LBFANAT Lv 1 1 pt. 7,964
  7. Avatar for NotJim99 207. NotJim99 Lv 1 1 pt. 7,950
  8. Avatar for wiktoriusz 208. wiktoriusz Lv 1 1 pt. 7,949
  9. Avatar for nsmangat 209. nsmangat Lv 1 1 pt. 7,946
  10. Avatar for sor2018 210. sor2018 Lv 1 1 pt. 7,911

Comments